From 0b6d4562030b057d8f6f5287497a2c007bdac548 Mon Sep 17 00:00:00 2001
From: Martin Steinegger <martin.steinegger@mpibpc.mpg.de>
Date: Mon, 18 Nov 2024 08:19:05 +0100
Subject: [PATCH] Switch to High RAM type

---
 Boltz1.ipynb | 5 ++---
 1 file changed, 2 insertions(+), 3 deletions(-)

diff --git a/Boltz1.ipynb b/Boltz1.ipynb
index e3282518..a176e94f 100644
--- a/Boltz1.ipynb
+++ b/Boltz1.ipynb
@@ -5,8 +5,7 @@
     "colab": {
       "provenance": [],
       "machine_shape": "hm",
-      "gpuType": "A100",
-      "authorship_tag": "ABX9TyOQII3DEBf33DR8Jfw5yz60",
+      "gpuType": "T4",
       "include_colab_link": true
     },
     "kernelspec": {
@@ -58,7 +57,7 @@
         "    return x + \"_\" + hashlib.sha1(y.encode()).hexdigest()[:5]\n",
         "\n",
         "# User inputs\n",
-        "query_sequence = 'PIAQIHILEGRSDEQKETLIREVSEAISRSLDAPLTSVRVIITEMAKGHFGIGGELASKKK'  #@param {type:\"string\"}\n",
+        "query_sequence = 'PIAQIHILEGRSDEQKETLIREVSEAISRSLDAPLTSVRVIITEMAKGHFGIGGELASKK'  #@param {type:\"string\"}\n",
         "#@markdown  - Use `:` to specify inter-protein chainbreaks for **modeling complexes** (supports homo- and hetro-oligomers). For example **PI...SK:PI...SK** for a homodimer\n",
         "ligand_input = 'N[C@@H](Cc1ccc(O)cc1)C(=O)O'  #@param {type:\"string\"}\n",
         "#@markdown  - Use `:` to specify multiple ligands as smile strings\n",